PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2164_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 237aa    MW: 27251.8 Da    PI: 9.7102
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2164_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-171158148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+WT++Ede+l ++++ +G g+W+t +++ g+ R++k+c++rw +yl
  cra_locus_2164_iso_2_len_936_ver_3 11 KGAWTKQEDEKLTNYIRTHGEGCWRTLPKEAGLQRCGKSCRLRWINYL 58
                                        79********************************************97 PP

2Myb_DNA-binding51.81.8e-1664108147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                         rg++ ++E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++
  cra_locus_2164_iso_2_len_936_ver_3  64 RGNFAQDEEDLIVKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 108
                                         89999*****************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.029658IPR017930Myb domain
SuperFamilySSF466892.85E-288105IPR009057Homeodomain-like
SMARTSM007178.9E-131060IPR001005SANT/Myb domain
PfamPF002498.7E-151158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-221265IPR009057Homeodomain-like
CDDcd001674.12E-101358No hitNo description
PROSITE profilePS5129426.15159113IPR017930Myb domain
SMARTSM007178.7E-1563111IPR001005SANT/Myb domain
PfamPF002491.7E-1464108IPR001005SANT/Myb domain
CDDcd001671.40E-966109No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2566114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MRKPCCEGKN KGAWTKQEDE KLTNYIRTHG EGCWRTLPKE AGLQRCGKSC RLRWINYLRP  60
DIKRGNFAQD EEDLIVKLHA LLGNRWSLIA GRLPGRTDNE VKNYWNSHIR RKLIKMGIDP  120
NNHRPKTIPG FQNRRLDTIS PSKPPIYGDD DDEQVVSDGT SGFINDDEKR LRTNCDINLD  180
LTIAFPSPSP SSSPKYSING EIKKKELTNK SQYNMNNNKF STKEVEGESF PTLVLFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28111137108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281006.19e-91myb-related protein 308-like
RefseqXP_002273328.16e-91PREDICTED: transcription repressor MYB6
RefseqXP_008229231.19e-91PREDICTED: myb-related protein 308-like
SwissprotP813932e-74MYB08_ANTMA; Myb-related protein 308
TrEMBLX2GMH53e-91X2GMH5_MALMI; MYB111
TrEMBLX2GR613e-91X2GR61_9R
TrEMBLW5S7043e-91W5S704_9R
STRINGVIT_14s0006g01620.t012e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154